PPCDC anticorps (N-Term)

N° du produit ABIN629813

Détail du produit anti-PPCDC anticorps

Antigène: PPCDC (phosphopantothenoylcysteine Decarboxylase (PPCDC))

Épitope: N-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPCDC est non-conjugé

Application: Western Blotting (WB)

Specificité: PPCDC antibody was raised against the N terminal of PPCDC

Purification: Purified

Immunogène: PPCDC antibody was raised using the N terminal of PPCDC corresponding to a region with amino acids VTTERAKHFYSPQDIPVTLYSDADEWEIWKSRSDPVLHIDLRRWADLLLV

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPCDC Blocking Peptide, catalog no. 33R-9859, is also available for use as a blocking control in assays to test for specificity of this PPCDC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPCDC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPCDC

Antigène: PPCDC (phosphopantothenoylcysteine Decarboxylase (PPCDC))

Autre désignation: PPCDC (PPCDC Produits)

Synonymes: anticorps MDS018, anticorps 1810057I13Rik, anticorps 8430432M10Rik, anticorps RGD1306267, anticorps phosphopantothenoylcysteine decarboxylase, anticorps PPCDC, anticorps Ppcdc

Sujet: Biosynthesis of coenzyme A (CoA) from pantothenic acid (vitamin B5) is an essential universal pathway in prokaryotes and eukaryotes. PPCDC, one of the last enzymes in this pathway, converts phosphopantothenoylcysteine to 4-prime-phosphopantetheine.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process