PUS7 anticorps

N° du produit ABIN629814

Détail du produit anti-PUS7 anticorps

Antigène: PUS7 (Pseudouridylate Synthase 7 Homolog (PUS7))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PUS7 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: PUS7 antibody was raised using a synthetic peptide corresponding to a region with amino acids FADMMKHGLTEADVGITKFVSSHQGFSGILKERYSDFVVHEIGKDGRISH

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PUS7 Blocking Peptide, catalog no. 33R-2838, is also available for use as a blocking control in assays to test for specificity of this PUS7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PUS7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PUS7

Antigène: PUS7 (Pseudouridylate Synthase 7 Homolog (PUS7))

Autre désignation: PUS7 (PUS7 Produits)

Synonymes: anticorps C330017I15Rik, anticorps RGD1307054, anticorps pseudouridylate synthase 7 (putative), anticorps pseudouridylate synthase 7 homolog, anticorps pseudouridylate synthase 7 (putative) L homeolog, anticorps pseudouridylate synthase 7 homolog (S. cerevisiae), anticorps pseudouridylate synthase 7, anticorps PUS7, anticorps LOC100449507, anticorps pus7, anticorps pus7.L, anticorps Pus7

Sujet: PUS7 is involved in RNA binding, pseudouridine synthase activity and isomerase activity.

Poids moléculaire: 75 kDa (MW of target protein)