PRMT1 anticorps (Middle Region)

N° du produit ABIN629816

Détail du produit anti-PRMT1 anticorps

Antigène: PRMT1 (Protein Arginine Methyltransferase 1 (PRMT1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRMT1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: PRMT1 antibody was raised against the middle region of PRMT1

Purification: Purified

Immunogène: PRMT1 antibody was raised using the middle region of PRMT1 corresponding to a region with amino acids ESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVY

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRMT1 Blocking Peptide, catalog no. 33R-2736, is also available for use as a blocking control in assays to test for specificity of this PRMT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRMT1

Antigène: PRMT1 (Protein Arginine Methyltransferase 1 (PRMT1))

Autre désignation: PRMT1 (PRMT1 Produits)

Synonymes: anticorps ANM1, anticorps HCP1, anticorps HRMT1L2, anticorps IR1B4, anticorps 6720434D09Rik, anticorps AW214366, anticorps Hrmt1l2, anticorps Mrmt1, anticorps 3E10, anticorps anm1, anticorps hcp1, anticorps hrmt1l2, anticorps ir1b4, anticorps prmt1, anticorps prmt1b, anticorps xPRMT1b, anticorps xprmt1, anticorps xPRMT1, anticorps ARABIDOPSIS THALIANA PROTEIN ARGININE METHYLTRANSFERASE 1A, anticorps ATPRMT1A, anticorps F6F22.30, anticorps F6F22_30, anticorps protein arginine methyltransferase 1A, anticorps DDBDRAFT_0183976, anticorps DDBDRAFT_0235399, anticorps DDB_0183976, anticorps DDB_0235399, anticorps PRMT1, anticorps DKFZp459J1326, anticorps fb39h07, anticorps wu:fb39h07, anticorps zf1, anticorps zgc:66201, anticorps protein arginine methyltransferase 1, anticorps protein arginine N-methyltransferase 1, anticorps protein arginine methyltransferase 1 L homeolog, anticorps protein arginine methyltransferase 1 S homeolog, anticorps protein arginine methyltransferase 1A, anticorps protein arginine N-methyltransferase-1, anticorps protein arginine N-methyltransferase, anticorps protein arginine methyltransferase, anticorps PRMT1, anticorps Prmt1, anticorps prmt1.L, anticorps prmt1.S, anticorps PRMT1A, anticorps prm-1, anticorps EDI_007800, anticorps Smp_029240.3, anticorps prmt1

Sujet: PRMT1 is a protein arginine methyltransferase that functions as a histone methyltransferase specific for H4.

Poids moléculaire: 40 kDa (MW of target protein)