Eukaryotic Translation Initiation Factor 3, Subunit M (EIF3M) (N-Term) anticorps

N° du produit ABIN629825

Détail du produit

Antigène: Eukaryotic Translation Initiation Factor 3, Subunit M (EIF3M)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: EIF3 M antibody was raised against the N terminal of EIF3

Purification: Purified

Immunogène: EIF3 M antibody was raised using the N terminal of EIF3 corresponding to a region with amino acids MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EIF3M Blocking Peptide, catalog no. 33R-6523, is also available for use as a blocking control in assays to test for specificity of this EIF3M antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: Eukaryotic Translation Initiation Factor 3, Subunit M (EIF3M)

Autre désignation: EIF3M (EIF3M Produits)

Synonymes: anticorps ga17, anticorps pcid1, anticorps hfl-b5, anticorps tango7, anticorps MGC69424, anticorps PCID1, anticorps DKFZp459D197, anticorps Ga17, anticorps Pcid1, anticorps Tango7, anticorps B5, anticorps TANGO7, anticorps hfl-B5, anticorps GA17, anticorps fa16c10, anticorps wu:fa16c10, anticorps wu:fc41f09, anticorps zgc:63996, anticorps HFL-B5, anticorps RGD1565840, anticorps eukaryotic translation initiation factor 3 subunit M, anticorps eukaryotic translation initiation factor 3, subunit M, anticorps eukaryotic translation initiation factor 3 subunit M S homeolog, anticorps eif3m, anticorps EIF3M, anticorps Eif3m, anticorps eif3m.S

Classe de substances: Viral Protein

Sujet: EIF3M is a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV).HFLB5 encodes a broadly expressed protein containing putative membrane fusion domains that acts as a receptor or coreceptor for entry of herpes simplex virus (HSV).

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization