UROD anticorps (N-Term)

N° du produit ABIN629827

Détail du produit anti-UROD anticorps

Antigène: UROD (Uroporphyrinogen Decarboxylase (UROD))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UROD est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: UROD antibody was raised against the N terminal of UROD

Purification: Purified

Immunogène: UROD antibody was raised using the N terminal of UROD corresponding to a region with amino acids SLLLLLFLFIVIFALLGMQLFGGRYDFEDTEVRRSNFDNFPQALISVFQV

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UROD Blocking Peptide, catalog no. 33R-8607, is also available for use as a blocking control in assays to test for specificity of this UROD antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UROD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UROD

Antigène: UROD (Uroporphyrinogen Decarboxylase (UROD))

Autre désignation: UROD (UROD Produits)

Synonymes: anticorps UROD, anticorps pct, anticorps wu:fc43e09, anticorps PCT, anticorps UPD, anticorps AI323803, anticorps Uro-d, anticorps porphyrinogen carboxy-lyase, anticorps uroporphyrinogen decarboxylase, anticorps Uroporphyrinogen decarboxylase UroD, anticorps Uroporphyrinogen decarboxylase, anticorps UROD, anticorps urod, anticorps hemE, anticorps uroD, anticorps Cpin_6502, anticorps Rmar_1187, anticorps LOC5568261, anticorps Mrub_1403, anticorps Arnit_2230, anticorps Ndas_2830, anticorps Mesil_2989, anticorps Trad_0222, anticorps Weevi_0432, anticorps Hipma_1229, anticorps Fluta_0529, anticorps Marky_1143, anticorps Halhy_5610, anticorps Mesop_0899, anticorps Ccan_20670, anticorps Urod

Sujet: UROD is the fifth enzyme of the heme biosynthetic pathway. This enzyme is responsible for catalyzing the conversion of uroporphyrinogen to coproporphyrinogen through the removal of four carboxymethyl side chains. Mutations and deficiency in this enzyme are known to cause familial porphyria cutanea tarda and hepatoerythropoetic porphyria.

Poids moléculaire: 40 kDa (MW of target protein)