PRPS2 anticorps (N-Term)

N° du produit ABIN629828

Détail du produit anti-PRPS2 anticorps

Antigène: PRPS2 (phosphoribosyl Pyrophosphate Synthetase 2 (PRPS2))

Épitope: N-Term

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRPS2 est non-conjugé

Application: Western Blotting (WB)

Specificité: PRPS2 antibody was raised against the N terminal of PRPS2

Purification: Purified

Immunogène: PRPS2 antibody was raised using the N terminal of PRPS2 corresponding to a region with amino acids MPNIVLFSGSSHQDLSQRVADRLGLELGKVVTKKFSNQETSVEIGESVRG

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRPS2 Blocking Peptide, catalog no. 33R-6299, is also available for use as a blocking control in assays to test for specificity of this PRPS2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRPS2

Antigène: PRPS2 (phosphoribosyl Pyrophosphate Synthetase 2 (PRPS2))

Autre désignation: PRPS2 (PRPS2 Produits)

Synonymes: anticorps prsii, anticorps PRSII, anticorps 2610101M19Rik, anticorps AA589463, anticorps AI464149, anticorps Prps-2, anticorps phosphoribosyl pyrophosphate synthetase 2 L homeolog, anticorps phosphoribosyl pyrophosphate synthetase 2, anticorps prps2.L, anticorps PRPS2, anticorps Prps2

Sujet: PRPS2 is a phosphoribosyl pyrophosphate synthetase that plays a central role in the synthesis of purines and pyrimidines.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process