MAP3K7CL anticorps (C-Term)

N° du produit ABIN629829

Détail du produit anti-MAP3K7CL anticorps

Antigène: MAP3K7CL (MAP3K7 C-Terminal Like (MAP3K7CL))

Épitope: C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAP3K7CL est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: C21 ORF7 antibody was raised against the C terminal Of C21 rf7

Purification: Purified

Immunogène: C21 ORF7 antibody was raised using the C terminal Of C21 rf7 corresponding to a region with amino acids DSEESMEVFKQHCQIAEEYHEVKKEITLLEQRKKELIAKLDQAEKEKVDA

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C21ORF7 Blocking Peptide, catalog no. 33R-2161, is also available for use as a blocking control in assays to test for specificity of this C21ORF7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAP3K7CL

Antigène: MAP3K7CL (MAP3K7 C-Terminal Like (MAP3K7CL))

Autre désignation: C21ORF7 (MAP3K7CL Produits)

Synonymes: anticorps C21orf7, anticorps ORF63, anticorps Tak1l, anticorps Map3k7 C-terminal like, anticorps Map3k7cl

Sujet: C21orf7 plays a critical role in the TGF-beta signaling transduction pathway.

Poids moléculaire: 27 kDa (MW of target protein)