ZBP1 anticorps (Middle Region)
-
- Antigène Voir toutes ZBP1 Anticorps
- ZBP1 (Z-DNA Binding Protein 1 (ZBP1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ZBP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ZBP1 antibody was raised against the middle region of ZBP1
- Purification
- Purified
- Immunogène
- ZBP1 antibody was raised using the middle region of ZBP1 corresponding to a region with amino acids LYRMKSRHLLDMDEQSKAWTIYRPEDSGRRAKSASIIYQHNPINMICQNG
- Top Product
- Discover our top product ZBP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZBP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ZBP1 (Z-DNA Binding Protein 1 (ZBP1))
- Autre désignation
- ZBP1 (ZBP1 Produits)
- Synonymes
- anticorps C20orf183, anticorps DAI, anticorps DLM-1, anticorps DLM1, anticorps 2010010H03Rik, anticorps Dai, anticorps Dlm1, anticorps mZaDLM, anticorps ZBP1, anticorps Z-DNA binding protein 1, anticorps ZBP1, anticorps Zbp1
- Sujet
- ZBP1 encodes a Z-DNA binding protein. Z-DNA formation is a dynamic process, largely controlled by the amount of supercoiling.
- Poids moléculaire
- 47 kDa (MW of target protein)
-