RGS16 anticorps (C-Term)

N° du produit ABIN629833

Détail du produit anti-RGS16 anticorps

Antigène: RGS16 (Regulator of G-Protein Signaling 16 (RGS16))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RGS16 est non-conjugé

Application: Western Blotting (WB)

Specificité: RGS16 antibody was raised against the C terminal of RGS16

Purification: Purified

Immunogène: RGS16 antibody was raised using the C terminal of RGS16 corresponding to a region with amino acids DAAQGKTRTLMEKDSYPRFLKSPAYRDLAAQASAASATLSSCSLDEPSHT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RGS16 Blocking Peptide, catalog no. 33R-1842, is also available for use as a blocking control in assays to test for specificity of this RGS16 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RGS16

Antigène: RGS16 (Regulator of G-Protein Signaling 16 (RGS16))

Autre désignation: RGS16 (RGS16 Produits)

Synonymes: anticorps A28-RGS14, anticorps A28-RGS14P, anticorps RGS-R, anticorps Rgs14, anticorps Rgsr, anticorps XRGSI, anticorps rgsI-A, anticorps zgc:110164, anticorps rgs16, anticorps regulator of G protein signaling 16, anticorps regulator of G-protein signaling 16, anticorps regulator of G-protein signaling 16 L homeolog, anticorps RGS16, anticorps Rgs16, anticorps rgs16.L, anticorps rgs16

Sujet: RGS16 belongs to the 'regulator of G protein signaling' family. It inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits. It also may play a role in regulating the kinetics of signaling in the phototransduction cascade.

Poids moléculaire: 23 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling