NNMT anticorps (N-Term)

N° du produit ABIN629835

Détail du produit anti-NNMT anticorps

Antigène: NNMT (Nicotinamide N-Methyltransferase (NNMT))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NNMT est non-conjugé

Application: Western Blotting (WB)

Specificité: NNMT antibody was raised against the N terminal of NNMT

Purification: Purified

Immunogène: NNMT antibody was raised using the N terminal of NNMT corresponding to a region with amino acids MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFC

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NNMT Blocking Peptide, catalog no. 33R-5957, is also available for use as a blocking control in assays to test for specificity of this NNMT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NNMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NNMT

Antigène: NNMT (Nicotinamide N-Methyltransferase (NNMT))

Autre désignation: NNMT (NNMT Produits)

Synonymes: anticorps MGC64498, anticorps Afu1g17750, anticorps AO090026000620, anticorps nnmt, anticorps nicotinamide N-methyltransferase S homeolog, anticorps nicotinamide N-methyltransferase, anticorps nicotinamide n-methyltransferase, anticorps Nicotinamide N-methyltransferase, anticorps nnmt.S, anticorps CNG02680, anticorps AFUA_1G17750, anticorps AOR_1_1132194, anticorps AOR_1_1124014, anticorps CC1G_02598, anticorps VDBG_08111, anticorps TERG_00572, anticorps Tsp_04293, anticorps nnmt, anticorps NNMT, anticorps Nnmt

Sujet: N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver. NNMT responsible for this enzymatic activity which uses S-adenosyl methionine as the methyl donor. N-methylation is one method by which drug and other xenobiotic compounds are metabolized by the liver.

Poids moléculaire: 29 kDa (MW of target protein)