TRABD anticorps (N-Term)

N° du produit ABIN629842

Détail du produit anti-TRABD anticorps

Antigène: TRABD (TraB Domain Containing (TRABD))

Épitope: N-Term

Reactivité: Souris, Rat, Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRABD est non-conjugé

Application: Western Blotting (WB)

Specificité: PP2447 antibody was raised against the N terminal Of Pp2447

Purification: Purified

Immunogène: PP2447 antibody was raised using the N terminal Of Pp2447 corresponding to a region with amino acids MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMK

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PP2447 Blocking Peptide, catalog no. 33R-5833, is also available for use as a blocking control in assays to test for specificity of this PP2447 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PP2447 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRABD

Antigène: TRABD (TraB Domain Containing (TRABD))

Autre désignation: PP2447 (TRABD Produits)

Synonymes: anticorps TRABD, anticorps LP6054, anticorps PP2447, anticorps fb66c10, anticorps wu:fb66c10, anticorps wu:fi04e11, anticorps zgc:66436, anticorps 5730502D15Rik, anticorps AL023039, anticorps RGD1310875, anticorps TraB domain containing, anticorps TraB domain containing L homeolog, anticorps TRABD, anticorps trabd, anticorps trabd.L, anticorps Trabd

Sujet: The function of PP2447 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 41 kDa (MW of target protein)