METTL13 anticorps (C-Term)

N° du produit ABIN629845

Détail du produit anti-METTL13 anticorps

Antigène: METTL13 (Methyltransferase Like 13 (METTL13))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp METTL13 est non-conjugé

Application: Western Blotting (WB)

Specificité: KIAA0859 antibody was raised against the C terminal of KIAA0859

Purification: Purified

Immunogène: KIAA0859 antibody was raised using the C terminal of KIAA0859 corresponding to a region with amino acids NEILFCQLHPEQKLATPELLETAQALERTLRKPGRGWDDTYVLSDMLKTV

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KIAA0859 Blocking Peptide, catalog no. 33R-6670, is also available for use as a blocking control in assays to test for specificity of this KIAA0859 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIAA0859 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur METTL13

Antigène: METTL13 (Methyltransferase Like 13 (METTL13))

Autre désignation: KIAA0859 (METTL13 Produits)

Synonymes: anticorps METTL13, anticorps KIAA0859, anticorps cgi-01, anticorps kiaa0859, anticorps RGD1311526, anticorps 5630401D24Rik, anticorps feat, anticorps si:dkey-19f21.2, anticorps zgc:152769, anticorps methyltransferase like 13, anticorps methyltransferase like 13 S homeolog, anticorps METTL13, anticorps mettl13, anticorps Mettl13, anticorps mettl13.S

Sujet: The function of KIAA0859 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 60 kDa (MW of target protein)