RBP1 anticorps (Middle Region)

N° du produit ABIN629847

Détail du produit anti-RBP1 anticorps

Antigène: RBP1 (Retinol Binding Protein 1, Cellular (RBP1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: RBP1 antibody was raised against the middle region of RBP1

Purification: Purified

Immunogène: RBP1 antibody was raised using the middle region of RBP1 corresponding to a region with amino acids IIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKG

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBP1 Blocking Peptide, catalog no. 33R-4007, is also available for use as a blocking control in assays to test for specificity of this RBP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBP1

Antigène: RBP1 (Retinol Binding Protein 1, Cellular (RBP1))

Autre désignation: RBP1 (RBP1 Produits)

Synonymes: anticorps RBBP-1, anticorps RBBP1, anticorps RBP-1, anticorps RBP1, anticorps CRABP-I, anticorps CRBP, anticorps CRBP1, anticorps CRBPI, anticorps RBPC, anticorps cb465, anticorps rbp1, anticorps wu:fb75e07, anticorps zgc:73335, anticorps CRABP1, anticorps Crbp, anticorps Rbp-1, anticorps rbp1b, anticorps sb:eu611, anticorps zgc:100825, anticorps AT-rich interaction domain 4A, anticorps retinol binding protein 1, anticorps retinol binding protein 1a, cellular, anticorps retinol binding protein 1 L homeolog, anticorps retinol binding protein 1, cellular, anticorps retinol binding protein 1b, cellular, anticorps ARID4A, anticorps RBP1, anticorps rbp5, anticorps rbp1.L, anticorps rbp1, anticorps Rbp1

Sujet: RBP1 is the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision.

Poids moléculaire: 15 kDa (MW of target protein)