MTMR1 anticorps (C-Term)

N° du produit ABIN629848

Détail du produit anti-MTMR1 anticorps

Antigène: MTMR1 (Myotubularin Related Protein 1 (MTMR1))

Épitope: C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MTMR1 est non-conjugé

Application: Western Blotting (WB)

Specificité: MTMR1 antibody was raised against the C terminal of MTMR1

Purification: Purified

Immunogène: MTMR1 antibody was raised using the C terminal of MTMR1 corresponding to a region with amino acids KEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MTMR1 Blocking Peptide, catalog no. 33R-4322, is also available for use as a blocking control in assays to test for specificity of this MTMR1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTMR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MTMR1

Antigène: MTMR1 (Myotubularin Related Protein 1 (MTMR1))

Autre désignation: MTMR1 (MTMR1 Produits)

Synonymes: anticorps AW049210, anticorps MTMR1, anticorps mtmr1, anticorps zgc:113282, anticorps Mtmr1, anticorps wu:fi27f12, anticorps zgc:113186, anticorps myotubularin related protein 1, anticorps myotubularin related protein 1a, anticorps myotubularin-related protein 1, anticorps myotubularin related protein 1b, anticorps MTMR1, anticorps Mtmr1, anticorps mtmr1a, anticorps mtmr1, anticorps LOC100725517, anticorps mtmr1b

Sujet: MTMR1 is a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases.

Poids moléculaire: 73 kDa (MW of target protein)

Pathways: Inositol Metabolic Process