AKR1B10 anticorps

N° du produit ABIN629851

Détail du produit anti-AKR1B10 anticorps

Antigène: AKR1B10 (Aldo-Keto Reductase Family 1, Member B10 (Aldose Reductase) (AKR1B10))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AKR1B10 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: AKR1 B10 antibody was raised using a synthetic peptide corresponding to a region with amino acids NEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDL

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AKR1B10 Blocking Peptide, catalog no. 33R-6669, is also available for use as a blocking control in assays to test for specificity of this AKR1B10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AKR0 10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AKR1B10

Antigène: AKR1B10 (Aldo-Keto Reductase Family 1, Member B10 (Aldose Reductase) (AKR1B10))

Autre désignation: AKR1B10 (AKR1B10 Produits)

Synonymes: anticorps AKR1B11, anticorps AKR1B12, anticorps ALDRLn, anticorps ARL-1, anticorps ARL1, anticorps HIS, anticorps HSI, anticorps 2310005E10Rik, anticorps Akr1b16, anticorps AKR, anticorps AKR1B10, anticorps Akr1b10, anticorps aldo-keto reductase family 1 member B10, anticorps aldo-keto reductase family 1, member B10 (aldose reductase), anticorps aldo-keto reductase family 1 member B10-like 2, anticorps AKR1B10, anticorps Akr1b10, anticorps AKR1B10L2, anticorps LOC100585902, anticorps LOC100723118, anticorps LOC101107697

Sujet: AKR1B10 is a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis.

Poids moléculaire: 35 kDa (MW of target protein)