PSG3 anticorps (N-Term)

N° du produit ABIN629852

Détail du produit anti-PSG3 anticorps

Antigène: PSG3 (Pregnancy Specific beta-1-Glycoprotein 3 (PSG3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSG3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: PSG3 antibody was raised against the N terminal of PSG3

Purification: Purified

Immunogène: PSG3 antibody was raised using the N terminal of PSG3 corresponding to a region with amino acids VYSNASLLIQNVTREDAGSYTLHIVKRGDGTRGETGHFTFTLYLETPKPS

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PSG3 Blocking Peptide, catalog no. 33R-9927, is also available for use as a blocking control in assays to test for specificity of this PSG3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSG3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PSG3

Antigène: PSG3 (Pregnancy Specific beta-1-Glycoprotein 3 (PSG3))

Autre désignation: PSG3 (PSG3 Produits)

Synonymes: anticorps PSG3, anticorps pregnancy specific beta-1-glycoprotein 3, anticorps pregnancy-specific beta-1-glycoprotein 3, anticorps PSG3, anticorps LOC741127

Sujet: The human pregnancy-specific glycoproteins (PSGs) are a family of proteins that are synthesized in large amounts by placental trophoblasts and released into the maternal circulation during pregnancy. Molecular cloning and analysis of several PSG genes has indicated that the PSGs form a subgroup of the carcinoembryonic antigen (CEA) gene family, which belongs to the immunoglobulin superfamily of genes.

Poids moléculaire: 16 kDa (MW of target protein)