LRRC2 anticorps (C-Term)

N° du produit ABIN629853

Détail du produit anti-LRRC2 anticorps

Antigène: LRRC2 (Leucine Rich Repeat Containing 2 (LRRC2))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRC2 est non-conjugé

Application: Western Blotting (WB)

Specificité: LRRC2 antibody was raised against the C terminal of LRRC2

Purification: Purified

Immunogène: LRRC2 antibody was raised using the C terminal of LRRC2 corresponding to a region with amino acids NAQCEDGNEIMESERDRQHFDKEVMKAYIEDLKERESVPSYTTKVSFSLQ

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRC2 Blocking Peptide, catalog no. 33R-6643, is also available for use as a blocking control in assays to test for specificity of this LRRC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRC2

Antigène: LRRC2 (Leucine Rich Repeat Containing 2 (LRRC2))

Autre désignation: LRRC2 (LRRC2 Produits)

Synonymes: anticorps 2400002D05Rik, anticorps 4933431K03Rik, anticorps leucine rich repeat containing 2, anticorps LRRC2, anticorps Lrrc2

Sujet: Leucine-rich repeats (LRRs) are 20-29 amino acid motifs that mediate proteinprotein interactions. The primary function of these motifs is to provide a versatile structural framework for the formation of these protein-protein interactions.

Poids moléculaire: 43 kDa (MW of target protein)