MORF4L1 anticorps (Middle Region)

N° du produit ABIN629857

Détail du produit anti-MORF4L1 anticorps

Antigène: MORF4L1 (Mortality Factor 4 Like 1 (MORF4L1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MORF4L1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: MORF4 L1 antibody was raised against the middle region of MORF4 1

Purification: Purified

Immunogène: MORF4 L1 antibody was raised using the middle region of MORF4 1 corresponding to a region with amino acids YAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQ

Information d'application

Indications d'application: WB: 5-10 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MORF4L1 Blocking Peptide, catalog no. 33R-10055, is also available for use as a blocking control in assays to test for specificity of this MORF4L1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MORF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MORF4L1

Antigène: MORF4L1 (Mortality Factor 4 Like 1 (MORF4L1))

Autre désignation: MORF4L1 (MORF4L1 Produits)

Synonymes: anticorps Eaf3, anticorps HsT17725, anticorps MEAF3, anticorps MORFRG15, anticorps MRG15, anticorps S863-6, anticorps TEG-189, anticorps Tex189, anticorps mKIAA4002, anticorps MORF4L2, anticorps CG6363, anticorps DmMRG15, anticorps Dmel\\CG6363, anticorps Dmrg15, anticorps Mrg15, anticorps dMRG15, anticorps dMrg15, anticorps l(3)j6A3, anticorps zgc:92289, anticorps mortality factor 4 like 1, anticorps MORF-related gene 15, anticorps MRG15, anticorps mortality factor 4 like 1 S homeolog, anticorps MORF4L1, anticorps Morf4l1, anticorps MRG15, anticorps CpipJ_CPIJ013367, anticorps morf4l1.S, anticorps morf4l1

Sujet: MORF4L1 is a novel chromodomain protein that is present in two distinct multiprotein complexes involved in transcriptional activation.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Chromatin Binding