STIP1 anticorps
-
- Antigène Voir toutes STIP1 Anticorps
- STIP1 (Stress-Induced-phosphoprotein 1 (STIP1))
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp STIP1 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogène
- STIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS
- Top Product
- Discover our top product STIP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
STIP1 Blocking Peptide, catalog no. 33R-10212, is also available for use as a blocking control in assays to test for specificity of this STIP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STIP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- STIP1 (Stress-Induced-phosphoprotein 1 (STIP1))
- Autre désignation
- STIP1 (STIP1 Produits)
- Synonymes
- anticorps HOP, anticorps IEF-SSP-3521, anticorps P60, anticorps STI1, anticorps STI1L, anticorps Hop, anticorps Sti1, anticorps p60, anticorps MGC53256, anticorps stip1, anticorps MGC76181, anticorps MGC82554, anticorps zgc:92133, anticorps stress induced phosphoprotein 1, anticorps stress-induced phosphoprotein 1, anticorps stress induced phosphoprotein 1 L homeolog, anticorps Stress-induced-phosphoprotein 1, anticorps stress-induced-phosphoprotein 1, anticorps stress induced phosphoprotein 1 S homeolog, anticorps STIP1, anticorps Stip1, anticorps stip1.L, anticorps GL50803_27310, anticorps PGTG_06468, anticorps stip1, anticorps stip1.S
- Sujet
- STIP1 mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).
- Poids moléculaire
- 63 kDa (MW of target protein)
-