LZTFL1 anticorps (C-Term)

N° du produit ABIN629864

Détail du produit anti-LZTFL1 anticorps

Antigène: LZTFL1 (Leucine Zipper Transcription Factor-Like 1 (LZTFL1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LZTFL1 est non-conjugé

Application: Western Blotting (WB)

Specificité: LZTFL1 antibody was raised against the C terminal of LZTFL1

Purification: Purified

Immunogène: LZTFL1 antibody was raised using the C terminal of LZTFL1 corresponding to a region with amino acids VQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LZTFL1 Blocking Peptide, catalog no. 33R-9745, is also available for use as a blocking control in assays to test for specificity of this LZTFL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LZTFL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LZTFL1

Antigène: LZTFL1 (Leucine Zipper Transcription Factor-Like 1 (LZTFL1))

Autre désignation: LZTFL1 (LZTFL1 Produits)

Synonymes: anticorps lztfl1, anticorps MGC53120, anticorps LZTFL1, anticorps DKFZp469B0113, anticorps fb53f12, anticorps wu:fb53f12, anticorps zgc:56268, anticorps BBS17, anticorps 5530402H04Rik, anticorps 6130400H19Rik, anticorps AI414725, anticorps AW048545, anticorps leucine zipper transcription factor like 1 L homeolog, anticorps leucine zipper transcription factor like 1, anticorps leucine zipper transcription factor-like 1, anticorps lztfl1.L, anticorps LZTFL1, anticorps lztfl1, anticorps Lztfl1

Sujet: LZTFL1 may be involved in vesicle-mediated transport.

Poids moléculaire: 34 kDa (MW of target protein)