TNNI2 anticorps
-
- Antigène Voir toutes TNNI2 Anticorps
- TNNI2 (Fast Skeletal Troponin I (TNNI2))
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TNNI2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- Troponin I Type 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLHIPGSMSEVQELCKQLHAKIDAAEEEKYDMEVRVQKTSKELEDMNQKL
- Top Product
- Discover our top product TNNI2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Troponin I Type 2 Blocking Peptide, catalog no. 33R-7190, is also available for use as a blocking control in assays to test for specificity of this Troponin I Type 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNNI2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TNNI2 (Fast Skeletal Troponin I (TNNI2))
- Abstract
- TNNI2 Produits
- Synonymes
- anticorps AMCD2B, anticorps DA2B, anticorps FSSV, anticorps fsTnI, anticorps TnI-F4, anticorps TnI, anticorps TNI, anticorps hm:zehn0173, anticorps tnni2, anticorps tropI-1d, anticorps zgc:86800, anticorps troponin I2, fast skeletal type, anticorps troponin I type 2 (skeletal, fast), anticorps troponin I, fast skeletal muscle-like, anticorps troponin I, skeletal, fast 2, anticorps troponin I type 2a (skeletal, fast), tandem duplicate 4, anticorps TNNI2, anticorps Tnni2, anticorps tnni2a.4
- Sujet
- Troponin I is the inhibitory subunit of troponin, the thin filament regulatory complex which confers calcium-sensitivity to striated muscle actomyosin ATPase activity.
- Poids moléculaire
- 21 kDa (MW of target protein)
-