Niban anticorps (N-Term)

N° du produit ABIN629867

Détail du produit anti-Niban anticorps

Antigène: Niban (FAM129A) (Family with Sequence Similarity 129, Member A (FAM129A))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Niban est non-conjugé

Application: Western Blotting (WB)

Specificité: FAM129 A antibody was raised against the N terminal of FAM129

Purification: Purified

Immunogène: FAM129 A antibody was raised using the N terminal of FAM129 corresponding to a region with amino acids SYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHFPDPLASSEKE

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAM129A Blocking Peptide, catalog no. 33R-8947, is also available for use as a blocking control in assays to test for specificity of this FAM129A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM120 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Niban

Antigène: Niban (FAM129A) (Family with Sequence Similarity 129, Member A (FAM129A))

Autre désignation: FAM129A (FAM129A Produits)

Synonymes: anticorps C1orf24, anticorps NIBAN, anticorps AI256368, anticorps AU019833, anticorps Niban, anticorps family with sequence similarity 129 member A, anticorps family with sequence similarity 129, member A, anticorps FAM129A, anticorps Fam129a

Sujet: FAM129A is expressed in subsets of thyroid tumors and Hashimoto's thyroiditis and it is a novel tumor marker.

Poids moléculaire: 103 kDa (MW of target protein)