ATIC anticorps (Middle Region)

N° du produit ABIN629868

Détail du produit anti-ATIC anticorps

Antigène: ATIC (5-Aminoimidazole-4-Carboxamide Ribonucleotide Formyltransferase/IMP Cyclohydrolase (ATIC))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATIC est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: ATIC antibody was raised against the middle region of ATIC

Purification: Purified

Immunogène: ATIC antibody was raised using the middle region of ATIC corresponding to a region with amino acids RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYT

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATIC Blocking Peptide, catalog no. 33R-8229, is also available for use as a blocking control in assays to test for specificity of this ATIC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATIC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATIC

Antigène: ATIC (5-Aminoimidazole-4-Carboxamide Ribonucleotide Formyltransferase/IMP Cyclohydrolase (ATIC))

Autre désignation: ATIC (ATIC Produits)

Synonymes: anticorps AICAR, anticorps AICARFT, anticorps IMPCHASE, anticorps PURH, anticorps purH, anticorps 2610509C24Rik, anticorps AA536954, anticorps AW212393, anticorps 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase L homeolog, anticorps bifunctional purine biosynthesis protein PurH, anticorps bifunctional purine biosynthesis protein purH, anticorps Bifunctional purine biosynthesis protein purH, anticorps Bifunctional purine biosynthesis protein PurH, anticorps 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase, anticorps atic.L, anticorps purH, anticorps ATIC, anticorps Atic

Sujet: ATIC is a bifunctional protein requiring dimerization for transformylase activity.

Poids moléculaire: 30 kDa (MW of target protein)