DDC anticorps

N° du produit ABIN629869

Détail du produit anti-DDC anticorps

Antigène: DDC (Dopa Decarboxylase (Aromatic L-Amino Acid Decarboxylase) (DDC))

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDC est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: DDC antibody was raised using a synthetic peptide corresponding to a region with amino acids EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDC Blocking Peptide, catalog no. 33R-2411, is also available for use as a blocking control in assays to test for specificity of this DDC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDC

Antigène: DDC (Dopa Decarboxylase (Aromatic L-Amino Acid Decarboxylase) (DDC))

Autre désignation: DDC (DDC Produits)

Synonymes: anticorps AADC, anticorps wu:fa56d05, anticorps wu:fd59h03, anticorps wu:fk20h01, anticorps zgc:65801, anticorps zgc:76929, anticorps Ddc, anticorps DdcDv, anticorps Dvir\\GJ17995, anticorps GJ17995, anticorps dvir_GLEANR_2561, anticorps Aadc, anticorps 5-HT, anticorps CG10697, anticorps DDC, anticorps DdcDm, anticorps Dmel\\CG10697, anticorps ddc, anticorps fDDC, anticorps l(2)37Bl, anticorps l(2)37Ch, anticorps l(2)k02104, anticorps dopa decarboxylase, anticorps Dopa-decarboxylase, anticorps dopa decarboxylase (aromatic L-amino acid decarboxylase), anticorps Dopa decarboxylase, anticorps dopa decarboxylase L homeolog, anticorps DDC, anticorps ddc, anticorps Ddc, anticorps Dvir\Ddc, anticorps ddc.L

Sujet: DDC catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.

Poids moléculaire: 53 kDa (MW of target protein)

Pathways: Dopaminergic Neurogenesis