PLIN1 anticorps (N-Term)
-
- Antigène Voir toutes PLIN1 Anticorps
- PLIN1 (Perilipin 1 (PLIN1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PLIN1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Perilipin antibody was raised against the N terminal of PLIN
- Purification
- Purified
- Immunogène
- Perilipin antibody was raised using the N terminal of PLIN corresponding to a region with amino acids STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS
- Top Product
- Discover our top product PLIN1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Perilipin Blocking Peptide, catalog no. 33R-8885, is also available for use as a blocking control in assays to test for specificity of this Perilipin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLIN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
Low Neonatal Plasma n-6/n-3 PUFA Ratios Regulate Offspring Adipogenic Potential and Condition Adult Obesity Resistance." dans: Diabetes, Vol. 67, Issue 4, pp. 651-661, (2018) (PubMed).
: "
-
Low Neonatal Plasma n-6/n-3 PUFA Ratios Regulate Offspring Adipogenic Potential and Condition Adult Obesity Resistance." dans: Diabetes, Vol. 67, Issue 4, pp. 651-661, (2018) (PubMed).
-
- Antigène
- PLIN1 (Perilipin 1 (PLIN1))
- Autre désignation
- Perilipin (PLIN1 Produits)
- Synonymes
- anticorps FPLD4, anticorps PERI, anticorps PLIN, anticorps PERIA, anticorps Plin, anticorps 6030432J05Rik, anticorps Peri, anticorps peri, anticorps plin, anticorps perilipin, anticorps LOC692833, anticorps perilipin 1, anticorps perilipin, anticorps perilipin 1 L homeolog, anticorps PLIN1, anticorps Plin1, anticorps plin1, anticorps LOC692833, anticorps plin1.L
- Sujet
- PLIN coats lipid storage droplets in adipocytes, thereby protecting them until they can be broken down by hormone-sensitive lipase. The protein is the major cAMP-dependent protein kinase substrate in adipocytes and, when unphosphorylated, may play a role in the inhibition of lipolysis.
- Poids moléculaire
- 57 kDa (MW of target protein)
- Pathways
- Lipid Metabolism
-