BRK1 anticorps (Middle Region)

N° du produit ABIN629872

Détail du produit anti-BRK1 anticorps

Antigène: BRK1 (BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BRK1 est non-conjugé

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Specificité: C3 ORF10 antibody was raised against the middle region of C3 rf10

Purification: Purified

Immunogène: C3 ORF10 antibody was raised using the middle region of C3 rf10 corresponding to a region with amino acids YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C3ORF10 Blocking Peptide, catalog no. 33R-10134, is also available for use as a blocking control in assays to test for specificity of this C3ORF10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BRK1

Antigène: BRK1 (BRICK1, SCAR/WAVE Actin-Nucleating Complex Subunit (BRK1))

Autre désignation: C3ORF10 (BRK1 Produits)

Synonymes: anticorps brk1, anticorps C22H3orf10, anticorps brick1, anticorps c3orf10, anticorps C3orf10, anticorps MDS027, anticorps hHBrk1, anticorps 6720456B07Rik, anticorps AW011779, anticorps ATBRK1, anticorps BRICK1, anticorps HSPC300, anticorps T9I22.8, anticorps T9I22_8, anticorps BRICK1, SCAR/WAVE actin-nucleating complex subunit, anticorps BRICK1, SCAR/WAVE actin nucleating complex subunit, anticorps brick 1, anticorps BRICK1, SCAR/WAVE actin-nucleating complex subunit S homeolog, anticorps BRICK1, anticorps brk1, anticorps BRK1, anticorps Brk1, anticorps brk1.S

Sujet: C3orf10 is involved in regulation of actin and microtubule organization. It is a part of a WAVE complex that activates the Arp2/3 complex.

Poids moléculaire: 9 kDa (MW of target protein)

Pathways: Signalisation RTK