TMEM108 anticorps (Middle Region)

N° du produit ABIN629878

Détail du produit anti-TMEM108 anticorps

Antigène: TMEM108 (Transmembrane Protein 108 (TMEM108))

Épitope: Middle Region

Reactivité: Humain, Souris, Chien, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM108 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM108 antibody was raised against the middle region of TMEM108

Purification: Purified

Immunogène: TMEM108 antibody was raised using the middle region of TMEM108 corresponding to a region with amino acids NRLVPAGTWKPGTAGNISHVAEGDKPQHRATICLSKMDIAWVILAISVPI

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM108 Blocking Peptide, catalog no. 33R-6859, is also available for use as a blocking control in assays to test for specificity of this TMEM108 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM108 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM108

Antigène: TMEM108 (Transmembrane Protein 108 (TMEM108))

Autre désignation: TMEM108 (TMEM108 Produits)

Synonymes: anticorps TMEM108, anticorps CT124, anticorps AI462967, anticorps B130017P16Rik, anticorps R74726, anticorps RGD1311530, anticorps transmembrane protein 108, anticorps TMEM108, anticorps Tmem108

Sujet: TMEM108's function has not been determined yet.

Poids moléculaire: 54 kDa (MW of target protein)