MOV10 anticorps

N° du produit ABIN629879

Détail du produit anti-MOV10 anticorps

Antigène: MOV10 (Moloney Leukemia Virus 10 (MOV10))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MOV10 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: MOV10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKLDLQQGQNLLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWR

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MOV10 Blocking Peptide, catalog no. 33R-1300, is also available for use as a blocking control in assays to test for specificity of this MOV10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOV10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MOV10

Antigène: MOV10 (Moloney Leukemia Virus 10 (MOV10))

Autre désignation: MOV10 (MOV10 Produits)

Synonymes: anticorps C77703, anticorps Mov-10, anticorps Capza1, anticorps fSAP113, anticorps gb110, anticorps Mov10 RISC complex RNA helicase, anticorps Moloney leukemia virus 10, anticorps MOV10, anticorps Mov10

Sujet: MOV10 may be an helicase with an important function in development and/or control of cell proliferation.

Poids moléculaire: 110 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, SARS-CoV-2 Protein Interactome