ERI1 anticorps (C-Term)

N° du produit ABIN629880

Détail du produit anti-ERI1 anticorps

Antigène: ERI1 (Exoribonuclease 1 (ERI1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ERI1 est non-conjugé

Application: Western Blotting (WB)

Specificité: THEX1 antibody was raised against the C terminal of theX1

Purification: Purified

Immunogène: THEX1 antibody was raised using the C terminal of theX1 corresponding to a region with amino acids GSWDMSKFLNIQCQLSRLKYPPFAKKWINIRKSYGNFYKVPRSQTKLTIM

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

THEX1 Blocking Peptide, catalog no. 33R-3597, is also available for use as a blocking control in assays to test for specificity of this THEX1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of THEX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ERI1

Antigène: ERI1 (Exoribonuclease 1 (ERI1))

Autre désignation: THEX1 (ERI1 Produits)

Synonymes: anticorps THEX1, anticorps thex1, anticorps zgc:110635, anticorps hexo, anticorps Eri-1, anticorps 3'HEXO, anticorps HEXO, anticorps 3'hexo, anticorps 3110010F15Rik, anticorps Thex1, anticorps eri-1, anticorps RGD1308378, anticorps exoribonuclease 1, anticorps three prime repair exonuclease 1, anticorps exoribonuclease 1 L homeolog, anticorps 3'-5' exonuclease eri-1, anticorps ERI1, anticorps CpipJ_CPIJ003945, anticorps eri1, anticorps eri1.L, anticorps Eri1, anticorps eri-1

Sujet: THEX1 contains 1 SAP domain and 1 exonuclease domain. It is an RNA exonuclease that binds to the 3' end of histone mRNAs and probably degrades them, suggesting that it plays an essential role in histone mRNA decay after replication. It is also able to degrade the 3' overhangs of short interfering RNAs (siRNAs) in vitro, suggesting a possible role as regulator of RNA interference (RNAi).

Poids moléculaire: 38 kDa (MW of target protein)