DDX49 anticorps

N° du produit ABIN629881

Détail du produit anti-DDX49 anticorps

Antigène: DDX49 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 49 (DDX49))

Reactivité: Humain, Chien, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDX49 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: DDX49 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGR

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDX49 Blocking Peptide, catalog no. 33R-2530, is also available for use as a blocking control in assays to test for specificity of this DDX49 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX49 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDX49

Antigène: DDX49 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 49 (DDX49))

Autre désignation: DDX49 (DDX49 Produits)

Synonymes: anticorps MGC76291, anticorps r27090_2, anticorps DDX49, anticorps wu:fb82g04, anticorps wu:fd12e05, anticorps ddx49-a, anticorps R27090_2, anticorps DEAD-box helicase 49, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 49, anticorps DEAD-box helicase 49 S homeolog, anticorps ddx49, anticorps DDX49, anticorps ddx49.S, anticorps Ddx49

Sujet: The function of Anti-DDX49 has not yet been determined.

Poids moléculaire: 53 kDa (MW of target protein)