CSDC2 anticorps (N-Term)

N° du produit ABIN629884

Détail du produit anti-CSDC2 anticorps

Antigène: CSDC2 (Cold Shock Domain Containing C2, RNA Binding (CSDC2))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CSDC2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: CSDC2 antibody was raised against the N terminal of CSDC2

Purification: Purified

Immunogène: CSDC2 antibody was raised using the N terminal of CSDC2 corresponding to a region with amino acids MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRVWERGGVPPRDLPSPLP

Information d'application

Indications d'application: WB: 0.625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CSDC2 Blocking Peptide, catalog no. 33R-6562, is also available for use as a blocking control in assays to test for specificity of this CSDC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSDC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CSDC2

Antigène: CSDC2 (Cold Shock Domain Containing C2, RNA Binding (CSDC2))

Autre désignation: CSDC2 (CSDC2 Produits)

Synonymes: anticorps pippin, anticorps csdc2, anticorps zgc:91826, anticorps PIPPIN, anticorps dJ347H13.2, anticorps AI415250, anticorps AI481750, anticorps Pippin, anticorps cold shock domain containing C2, RNA binding, anticorps cold shock domain containing C2, anticorps cold shock domain containing C2, RNA binding a, anticorps cold shock domain containing C2 L homeolog, anticorps CSDC2, anticorps csdc2, anticorps csdc2a, anticorps csdc2.L, anticorps Csdc2

Sujet: CSDC2 is an RNA-binding factor which binds specifically to the very 3'UTR ends of both histone H1 and H3.3 mRNAs, encompassing the polyadenylation signal. It might play a central role in the negative regulation of histone variant synthesis in the developing brain.

Poids moléculaire: 17 kDa (MW of target protein)