HNRNPA1 anticorps (N-Term)

N° du produit ABIN629885

Détail du produit anti-HNRNPA1 anticorps

Antigène: HNRNPA1 (Heterogeneous Nuclear Ribonucleoprotein A1 (HNRNPA1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HNRNPA1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: HNRPA1 antibody was raised against the N terminal of HNRPA1

Purification: Purified

Immunogène: HNRPA1 antibody was raised using the N terminal of HNRPA1 corresponding to a region with amino acids MSKSESPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HNRPA1 Blocking Peptide, catalog no. 33R-6455, is also available for use as a blocking control in assays to test for specificity of this HNRPA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HNRNPA1

Antigène: HNRNPA1 (Heterogeneous Nuclear Ribonucleoprotein A1 (HNRNPA1))

Autre désignation: HNRPA1 (HNRNPA1 Produits)

Synonymes: anticorps HNRPA1, anticorps HNRPA1L3, anticorps hnRNP A1, anticorps hnRNP-A1, anticorps hnrpa1, anticorps TPT1P, anticorps HNRNPA1, anticorps D15Ertd119e, anticorps Hdp, anticorps Hnrpa1, anticorps hnrnp-A1, anticorps ROA1, anticorps zgc:66127, anticorps heterogeneous nuclear ribonucleoprotein A1, anticorps heterogeneous nuclear ribonucleoprotein A1b, anticorps Heterogeneous nuclear ribonucleoprotein A1, anticorps heterogeneous nuclear ribonucleoprotein A1 S homeolog, anticorps ribonucleoprotein A1a, anticorps heterogeneous nuclear ribonucleoprotein A1-like, anticorps heterogeneous nuclear ribonucleoprotein A1a, anticorps HNRNPA1, anticorps hnrnpa1b, anticorps LOC100101226, anticorps roa1, anticorps Hnrnpa1, anticorps hnrnpa1.S, anticorps hnrnpa1, anticorps LOC100359118, anticorps hnrnpa1a

Sujet: HNRPA1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). HNRPA1 has two repeats of quasi-RRM domains that bind to RNAs. It is one of the most abundant core proteins of hnRNP complexes and it is localized to the nucleoplasm. HNRPA1 is involved in the packaging of pre-mRNA into hnRNP particles, transport of poly A+ mRNA from the nucleus to the cytoplasm, and may modulate splice site selection. It is also thought have a primary role in the formation of specific myometrial protein species in parturition.

Poids moléculaire: 35 kDa (MW of target protein)