PPP1R8 anticorps

N° du produit ABIN629887

Détail du produit anti-PPP1R8 anticorps

Antigène: PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPP1R8 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: PPP1 R8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKK

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPP1R8 Blocking Peptide, catalog no. 33R-7235, is also available for use as a blocking control in assays to test for specificity of this PPP1R8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPP1R8

Antigène: PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))

Autre désignation: PPP1R8 (PPP1R8 Produits)

Synonymes: anticorps ARD-1, anticorps ARD1, anticorps NIPP-1, anticorps NIPP1, anticorps PRO2047, anticorps 6330548N22Rik, anticorps AU044684, anticorps PPP1R8, anticorps ard-1, anticorps ard1, anticorps nipp-1, anticorps nipp1, anticorps ppp1r8, anticorps si:ch211-206a7.1, anticorps protein phosphatase 1 regulatory subunit 8, anticorps protein phosphatase 1, regulatory subunit 8, anticorps protein phosphatase 1, regulatory (inhibitor) subunit 8, anticorps protein phosphatase 1, regulatory subunit 8b, anticorps protein phosphatase 1 regulatory subunit 8 L homeolog, anticorps protein phosphatase 1, regulatory subunit 8a, anticorps protein phosphatase 1 regulatory subunit 8 S homeolog, anticorps PPP1R8, anticorps Ppp1r8, anticorps ppp1r8b, anticorps ppp1r8.L, anticorps ppp1r8a, anticorps ppp1r8.S

Sujet: This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA.

Poids moléculaire: 14 kDa (MW of target protein)