RBMS3 anticorps (C-Term)

N° du produit ABIN629891

Détail du produit anti-RBMS3 anticorps

Antigène: RBMS3 (RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3))

Épitope: C-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RBMS3 est non-conjugé

Application: Western Blotting (WB)

Specificité: RBMS3 antibody was raised against the C terminal of RBMS3

Purification: Purified

Immunogène: RBMS3 antibody was raised using the C terminal of RBMS3 corresponding to a region with amino acids TAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSKP

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RBMS3 Blocking Peptide, catalog no. 33R-8991, is also available for use as a blocking control in assays to test for specificity of this RBMS3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBMS3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RBMS3

Antigène: RBMS3 (RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3))

Autre désignation: RBMS3 (RBMS3 Produits)

Synonymes: anticorps RBMS3, anticorps zgc:153698, anticorps 6720477E09Rik, anticorps 8430436O14Rik, anticorps RNA binding motif single stranded interacting protein 3, anticorps RNA binding motif, single stranded interacting protein, anticorps RNA binding motif, single stranded interacting protein 3, anticorps RBMS3, anticorps rbms3, anticorps Rbms3

Sujet: RBMS3 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis.

Poids moléculaire: 46 kDa (MW of target protein)