HNRPDL anticorps (Middle Region)

N° du produit ABIN629895

Détail du produit anti-HNRPDL anticorps

Antigène: HNRPDL (Heterogeneous Nuclear Ribonucleoprotein D-Like (HNRPDL))

Épitope: Middle Region

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HNRPDL est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: HNRPDL antibody was raised against the middle region of HNRPDL

Purification: Purified

Immunogène: HNRPDL antibody was raised using the middle region of HNRPDL corresponding to a region with amino acids TMEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYL

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HNRPDL Blocking Peptide, catalog no. 33R-9199, is also available for use as a blocking control in assays to test for specificity of this HNRPDL antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPDL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HNRPDL

Antigène: HNRPDL (Heterogeneous Nuclear Ribonucleoprotein D-Like (HNRPDL))

Autre désignation: HNRPDL (HNRPDL Produits)

Synonymes: anticorps wu:fa11d08, anticorps zgc:66169, anticorps hnRNP DL, anticorps Hnrpdl, anticorps AA407431, anticorps AA959857, anticorps D5Ertd650e, anticorps D5Wsu145e, anticorps JKTBP, anticorps hnRNP-DL, anticorps hnRNP, anticorps hnrpdl, anticorps hnrpdl-a, anticorps jktbp, anticorps jktbp2, anticorps laauf1, anticorps HNRNP, anticorps HNRPDL, anticorps JKTBP2, anticorps laAUF1, anticorps hnRNP D-like B, anticorps hnRNP DL-B, anticorps hnrnpdl-b, anticorps hnrpdl-b, anticorps heterogeneous nuclear ribonucleoprotein D-like, anticorps heterogeneous nuclear ribonucleoprotein D like, anticorps heterogeneous nuclear ribonucleoprotein D like L homeolog, anticorps heterogeneous nuclear ribonucleoprotein D like S homeolog, anticorps hnrpdl, anticorps HNRNPDL, anticorps Hnrnpdl, anticorps hnrnpdl.L, anticorps LOC100351670, anticorps LOC101120922, anticorps hnrnpdl.S

Sujet: HNRPDL belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. HNRPDL has two RRM domains that bind to RNAs.

Poids moléculaire: 40 kDa (MW of target protein)