HNRPDL anticorps (Middle Region)
-
- Antigène Voir toutes HNRPDL Anticorps
- HNRPDL (Heterogeneous Nuclear Ribonucleoprotein D-Like (HNRPDL))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HNRPDL est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- HNRPDL antibody was raised against the middle region of HNRPDL
- Purification
- Purified
- Immunogène
- HNRPDL antibody was raised using the middle region of HNRPDL corresponding to a region with amino acids TMEDMNEYSNIEEFAEGSKINASKNQQDDGKMFIGGLSWDTSKKDLTEYL
- Top Product
- Discover our top product HNRPDL Anticorps primaire
-
anti-Heterogeneous Nuclear Ribonucleoprotein D-Like (HNRPDL) (Middle Region) antibody
HNRPDL Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Cobaye, Poisson zèbre (Danio rerio), Cheval WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein D-Like (HNRPDL) (C-Term) antibodyHNRPDL Reactivité: Humain, Souris, Rat WB, ELISA, IHC, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein D-Like (HNRPDL) (AA 261-420) antibodyHNRPDL Reactivité: Humain WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein D-Like (HNRPDL) (AA 119-168) antibodyHNRPDL Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Cobaye, Poulet, Singe WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein D-Like (HNRPDL) (AA 206-234) antibodyHNRPDL Reactivité: Humain WB Hôte: Lapin Polyclonal RB26893 unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein D-Like (HNRPDL) antibodyHNRPDL Reactivité: Humain, Souris, Rat IF Hôte: Lapin Polyclonal unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein D-Like (HNRPDL) (C-Term) antibodyHNRPDL Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Cobaye, Poisson zèbre (Danio rerio), Cheval, Lapin, Poulet, Singe, Hamster, Porc WB Hôte: Lapin Polyclonal unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein D-Like (HNRPDL) (C-Term) antibodyHNRPDL Reactivité: Humain, Souris, Rat WB Hôte: Lapin Polyclonal unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein D-Like (HNRPDL) (C-Term) antibodyHNRPDL Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Cobaye, Poisson zèbre (Danio rerio), Cheval, Lapin WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HNRPDL Blocking Peptide, catalog no. 33R-9199, is also available for use as a blocking control in assays to test for specificity of this HNRPDL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPDL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HNRPDL (Heterogeneous Nuclear Ribonucleoprotein D-Like (HNRPDL))
- Autre désignation
- HNRPDL (HNRPDL Produits)
- Sujet
- HNRPDL belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. HNRPDL has two RRM domains that bind to RNAs.
- Poids moléculaire
- 40 kDa (MW of target protein)
-
