SURF6 anticorps (Middle Region)

N° du produit ABIN629898

Détail du produit anti-SURF6 anticorps

Antigène: SURF6 (Surfeit 6 (SURF6))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SURF6 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: SURF6 antibody was raised against the middle region of SURF6

Purification: Purified

Immunogène: SURF6 antibody was raised using the middle region of SURF6 corresponding to a region with amino acids EPREPPGLIFNKVEVSEDEPASKAQRRKEKRQRVKGNLTPLTGRNYRQLL

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SURF6 Blocking Peptide, catalog no. 33R-2644, is also available for use as a blocking control in assays to test for specificity of this SURF6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SURF6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SURF6

Antigène: SURF6 (Surfeit 6 (SURF6))

Autre désignation: SURF6 (SURF6 Produits)

Synonymes: anticorps RRP14, anticorps CG4510, anticorps Dmel\\CG4510, anticorps SURF6, anticorps surf6, anticorps MGC79828, anticorps D2Wsu129e, anticorps Surf-6, anticorps surf6l, anticorps zgc:64008, anticorps surfeit 6, anticorps Surfeit 6, anticorps surfeit locus protein 6 pseudogene, anticorps surfeit locus protein 6-like, anticorps surfeit gene 6, anticorps surfeit 6 L homeolog, anticorps SURF6, anticorps Surf6, anticorps LOC485740, anticorps surf6, anticorps LOC100222495, anticorps surf6.L

Sujet: This gene is located in the surfeit gene cluster, a group of very tightly linked genes that do not share sequence similarity. The gene demonstrates features of a housekeeping gene, being ubiquitously expressed, and the encoded protein has been localized to the nucleolus. The protein includes motifs found in both the mouse and fish orthologs, which suggests a putative function as a nucleolar-matrix protein with nucleic acid-binding properties, based on characteristics determined in mouse.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Ribosome Assembly