HNRNPH3 anticorps

N° du produit ABIN629899

Détail du produit anti-HNRNPH3 anticorps

Antigène: HNRNPH3 (Heterogeneous Nuclear Ribonucleoprotein H3 (2H9) (HNRNPH3))

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HNRNPH3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: HNRPH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids DYQGRSTGEAFVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFY

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HNRPH3 Blocking Peptide, catalog no. 33R-2244, is also available for use as a blocking control in assays to test for specificity of this HNRPH3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPH3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HNRNPH3

Antigène: HNRNPH3 (Heterogeneous Nuclear Ribonucleoprotein H3 (2H9) (HNRNPH3))

Autre désignation: HNRPH3 (HNRNPH3 Produits)

Synonymes: anticorps AA693301, anticorps AI666703, anticorps Hnrph3, anticorps hnrph3, anticorps HNRPH3, anticorps 2H9, anticorps heterogeneous nuclear ribonucleoprotein H3, anticorps heterogeneous nuclear ribonucleoprotein H3 L homeolog, anticorps Hnrnph3, anticorps hnrnph3.L, anticorps HNRNPH3

Sujet: HNRPH3 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties.

Poids moléculaire: 38 kDa (MW of target protein)