HNRNPL anticorps (N-Term)
-
- Antigène Voir toutes HNRNPL Anticorps
- HNRNPL (Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HNRNPL est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- HNRPL antibody was raised against the N terminal of HNRPL
- Purification
- Purified
- Immunogène
- HNRPL antibody was raised using the N terminal of HNRPL corresponding to a region with amino acids DTWDYTNPNLSGQGDPGSNPNKRQRQPPLLGDHPAEYGGPHGGYHSHYHD
- Top Product
- Discover our top product HNRNPL Anticorps primaire
-
anti-Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL) (AA 282-589) antibody
HNRNPL Reactivité: Humain WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL) (N-Term) antibodyHNRNPL Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Cobaye, Lapin, Cheval WB, IHC, IF, IP Hôte: Lapin Polyclonal unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL) (AA 249-277) antibodyHNRNPL Reactivité: Humain WB, IHC (p), FACS Hôte: Lapin Polyclonal RB20811 unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL) (AA 1-558) antibodyHNRNPL Reactivité: Humain WB, IF Hôte: Souris Polyclonal unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL) (N-Term) antibodyHNRNPL Reactivité: Humain, Souris WB, IHC, ELISA, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL) antibodyHNRNPL Reactivité: Humain, Souris, Xenopus laevis WB, ELISA, IF, IHC (p), IP, ICC Hôte: Souris Monoclonal 1G11 unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL) antibodyHNRNPL Reactivité: Humain, Souris, Rat, Triton WB, ELISA, IF, IHC (p), IP, FACS, ICC, IHC (fro) Hôte: Souris Monoclonal 4D11 unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL) (N-Term) antibodyHNRNPL Reactivité: Humain WB, IHC, ELISA, IF Hôte: Lapin Polyclonal unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL) (AA 89-335) antibodyHNRNPL Reactivité: Humain IHC, ELISA, IF Hôte: Lapin Polyclonal unconjugated
anti-Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL) (AA 461-490), (C-Term) antibodyHNRNPL Reactivité: Humain WB, IHC (p) Hôte: Lapin Polyclonal RB20812 unconjugated
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HNRPL Blocking Peptide, catalog no. 33R-2211, is also available for use as a blocking control in assays to test for specificity of this HNRPL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HNRNPL (Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL))
- Autre désignation
- HNRPL (HNRNPL Produits)
- Synonymes
- anticorps HNRPL, anticorps hnRNP-L, anticorps zgc:55429, anticorps HNRNPL, anticorps hnrpl, anticorps C79783, anticorps D830027H13Rik, anticorps Hnrpl, anticorps hnrnp-L, anticorps heterogeneous nuclear ribonucleoprotein L, anticorps HNRNPL, anticorps hnrpl, anticorps hnrnpl, anticorps Hnrnpl
- Sujet
- Heterogeneous nuclear RNAs (hnRNAs) which include mRNA precursors and mature mRNAs are associated with specific proteins to form heterogenous ribonucleoprotein (hnRNP) complexes. Heterogeneous nuclear ribonucleoprotein L is among the proteins that are stably associated with hnRNP complexes and along with other hnRNP proteins is likely to play a major role in the formation, packaging, processing, and function of mRNA.
- Poids moléculaire
- 65 kDa (MW of target protein)
-
