EXOSC4 anticorps (N-Term)
-
- Antigène Voir toutes EXOSC4 Anticorps
- EXOSC4 (Exosome Component 4 (EXOSC4))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EXOSC4 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- EXOSC4 antibody was raised against the N terminal of EXOSC4
- Purification
- Purified
- Immunogène
- EXOSC4 antibody was raised using the N terminal of EXOSC4 corresponding to a region with amino acids SDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHE
- Top Product
- Discover our top product EXOSC4 Anticorps primaire
-
anti-Exosome Component 4 (EXOSC4) (AA 1-100) antibody
EXOSC4 Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal 4F10 unconjugated
anti-Exosome Component 4 (EXOSC4) (N-Term) antibodyEXOSC4 Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Cheval, Cobaye, Lapin, Xenopus laevis, Singe, Porc WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Exosome Component 4 (EXOSC4) antibodyEXOSC4 Reactivité: Humain, Souris WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Exosome Component 4 (EXOSC4) (N-Term) antibodyEXOSC4 Reactivité: Humain, Souris, Rat, Chien, Boeuf (Vache), Cheval, Cobaye, Lapin, Saccharomyces cerevisiae, Poisson zèbre (Danio rerio) WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Exosome Component 4 (EXOSC4) (AA 69-96) antibodyEXOSC4 Reactivité: Humain WB Hôte: Lapin Polyclonal RB37090 unconjugated
anti-Exosome Component 4 (EXOSC4) (AA 1-245) antibodyEXOSC4 Reactivité: Humain WB, ELISA Hôte: Souris Polyclonal unconjugated
anti-Exosome Component 4 (EXOSC4) antibodyEXOSC4 Reactivité: Humain, Rat WB Hôte: Lapin Polyclonal unconjugated
anti-Exosome Component 4 (EXOSC4) (AA 1-245) antibodyEXOSC4 Reactivité: Humain WB, IHC Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EXOSC4 Blocking Peptide, catalog no. 33R-8366, is also available for use as a blocking control in assays to test for specificity of this EXOSC4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EXOSC4 (Exosome Component 4 (EXOSC4))
- Autre désignation
- EXOSC4 (EXOSC4 Produits)
- Synonymes
- anticorps EXOSC4, anticorps zgc:73175, anticorps RRP41, anticorps RRP41A, anticorps Rrp41p, anticorps SKI6, anticorps Ski6p, anticorps hRrp41p, anticorps p12A, anticorps 1110039I09Rik, anticorps 1500001N04Rik, anticorps Rrp41, anticorps exosome component 4, anticorps exosome component 4 S homeolog, anticorps exosc4, anticorps EXOSC4, anticorps CC1G_03561, anticorps exosc4.S, anticorps Exosc4
- Sujet
- EXOSC4 belongs to the RNase PH family. It is a component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA. It has a 3'-5' exonuclease activity.
- Poids moléculaire
- 27 kDa (MW of target protein)
-
