EXOSC10 anticorps (C-Term)
-
- Antigène Voir toutes EXOSC10 Anticorps
- EXOSC10 (Exosome Component 10 (EXOSC10))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp EXOSC10 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- EXOSC10 antibody was raised against the C terminal of EXOSC10
- Purification
- Purified
- Immunogène
- EXOSC10 antibody was raised using the C terminal of EXOSC10 corresponding to a region with amino acids FAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRG
- Top Product
- Discover our top product EXOSC10 Anticorps primaire
-
anti-Exosome Component 10 (EXOSC10) (C-Term) antibody
EXOSC10 Reactivité: Humain, Souris, Lapin, Boeuf (Vache), Rat, Chien, Cobaye, Cheval, Porc WB Hôte: Lapin Polyclonal unconjugated
anti-Exosome Component 10 (EXOSC10) (AA 41-140) antibodyEXOSC10 Reactivité: Humain, Souris WB, ELISA, IF (cc), IF (p), IHC (p), IHC (fro), ICC Hôte: Lapin Polyclonal unconjugated
anti-Exosome Component 10 (EXOSC10) (AA 1-99) antibodyEXOSC10 Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal 1E6 unconjugated
anti-Exosome Component 10 (EXOSC10) (AA 586-885) antibodyEXOSC10 Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-Exosome Component 10 (EXOSC10) (C-Term) antibodyEXOSC10 Reactivité: Humain, Souris, Lapin, Boeuf (Vache), Chien, Roussette (Chauve-souris) WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Exosome Component 10 (EXOSC10) (C-Term) antibodyEXOSC10 Reactivité: Humain, Souris, Lapin, Boeuf (Vache), Rat, Chien, Cobaye, Cheval WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Exosome Component 10 (EXOSC10) (AA 756-805) antibodyEXOSC10 Reactivité: Humain, Souris, Lapin, Boeuf (Vache), Chien WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
EXOSC10 Blocking Peptide, catalog no. 33R-2842, is also available for use as a blocking control in assays to test for specificity of this EXOSC10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXOSC10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- EXOSC10 (Exosome Component 10 (EXOSC10))
- Autre désignation
- EXOSC10 (EXOSC10 Produits)
- Synonymes
- anticorps Pmscl2, anticorps zgc:55695, anticorps pm-scl, anticorps pm/scl-100, anticorps pmscl, anticorps pmscl2, anticorps rrp6, anticorps rrp6p, anticorps EXOSC10, anticorps 201.t00018, anticorps 21.m02990, anticorps DDBDRAFT_0203581, anticorps DDBDRAFT_0233752, anticorps DDB_0203581, anticorps DDB_0233752, anticorps PM-Scl, anticorps PM/Scl-100, anticorps PMSCL, anticorps PMSCL2, anticorps RRP6, anticorps Rrp6p, anticorps p2, anticorps p3, anticorps p4, anticorps exosome component 10, anticorps 3'-5' exonuclease, anticorps exosome component 10 L homeolog, anticorps exosc10, anticorps EXOSC10, anticorps EHI_021400, anticorps BBOV_IV002650, anticorps CpipJ_CPIJ003896, anticorps CMU_031760, anticorps Tsp_05247, anticorps exosc10.L, anticorps Exosc10
- Sujet
- EXOSC10 contains 1 HRDC domain and 1 3'-5' exonuclease domain. Antibodies against PM/SCL are found in patients with polymyositis and/or scleroderma.
- Poids moléculaire
- 97 kDa (MW of target protein)
-
