SF3B1 anticorps (N-Term)

N° du produit ABIN629906

Détail du produit anti-SF3B1 anticorps

Antigène: SF3B1 (Splicing Factor 3b, Subunit 1, 155kDa (SF3B1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SF3B1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: SF3 B1 antibody was raised against the N terminal of SF3 1

Purification: Purified

Immunogène: SF3 B1 antibody was raised using the N terminal of SF3 1 corresponding to a region with amino acids MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYGGSDSR

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SF3B1 Blocking Peptide, catalog no. 33R-5678, is also available for use as a blocking control in assays to test for specificity of this SF3B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SF0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SF3B1

Antigène: SF3B1 (Splicing Factor 3b, Subunit 1, 155kDa (SF3B1))

Autre désignation: SF3B1 (SF3B1 Produits)

Synonymes: anticorps Cus1, anticorps SAP145, anticorps SF3B145, anticorps SF3b1, anticorps SF3b150, anticorps Hsh155, anticorps MDS, anticorps PRP10, anticorps PRPF10, anticorps SAP155, anticorps SF3b155, anticorps 155kDa, anticorps 2810001M05Rik, anticorps AA409119, anticorps Prp10, anticorps TA-8, anticorps Targ4, anticorps hsh155, anticorps prp10, anticorps prpf10, anticorps sap155, anticorps SF3B1, anticorps Sap155, anticorps wu:fb99f09, anticorps splicing factor 3b subunit 2, anticorps splicing factor 3b subunit 1, anticorps splicing factor 3b, subunit 1, anticorps splicing factor 3b subunit 1 S homeolog, anticorps SF3B2, anticorps SF3B1, anticorps Sf3b1, anticorps sf3b1.S, anticorps sf3b1

Sujet: SF3B1 is the subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome.

Poids moléculaire: 143 kDa (MW of target protein)

Pathways: Chromatin Binding