ISG20 anticorps (N-Term)

N° du produit ABIN629913

Détail du produit anti-ISG20 anticorps

Antigène: ISG20 (Interferon Stimulated Exonuclease Gene 20kDa (ISG20))

Épitope: N-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ISG20 est non-conjugé

Application: Western Blotting (WB)

Specificité: ISG20 antibody was raised against the N terminal of ISG20

Purification: Purified

Immunogène: ISG20 antibody was raised using the N terminal of ISG20 corresponding to a region with amino acids GAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFAVARLEILQLLKGK

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ISG20 Blocking Peptide, catalog no. 33R-3179, is also available for use as a blocking control in assays to test for specificity of this ISG20 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ISG20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ISG20

Antigène: ISG20 (Interferon Stimulated Exonuclease Gene 20kDa (ISG20))

Autre désignation: ISG20 (ISG20 Produits)

Synonymes: anticorps ISG20, anticorps CD25, anticorps HEM45, anticorps 1600023I01Rik, anticorps 2010107M23Rik, anticorps 20kDa, anticorps DnaQL, anticorps interferon stimulated exonuclease gene 20, anticorps interferon-stimulated protein, anticorps ISG20, anticorps Isg20

Sujet: ISG20 belongs to the the exonuclease superfamily. It is exonuclease with specificity for single-stranded RNA and, to a lesser extent for DNA. It degrades RNA at a rate that is approximately 35-fold higher than its rate for single-stranded DNA. It is involved in the antiviral function of IFN against RNA viruses.

Poids moléculaire: 20 kDa (MW of target protein)