ADAT1 anticorps (C-Term)

N° du produit ABIN629916

Détail du produit anti-ADAT1 anticorps

Antigène: ADAT1 (Adenosine Deaminase, tRNA-Specific 1 (ADAT1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADAT1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: ADAT1 antibody was raised against the C terminal of ADAT1

Purification: Purified

Immunogène: ADAT1 antibody was raised using the C terminal of ADAT1 corresponding to a region with amino acids RLVPCGAAISWSAVPEQPLDVTANGFPQGTTKKTIGSLQARSQISKVELF

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADAT1 Blocking Peptide, catalog no. 33R-8057, is also available for use as a blocking control in assays to test for specificity of this ADAT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADAT1

Antigène: ADAT1 (Adenosine Deaminase, tRNA-Specific 1 (ADAT1))

Autre désignation: ADAT1 (ADAT1 Produits)

Synonymes: anticorps ADAT1, anticorps zgc:162299, anticorps HADAT1, anticorps MMADAT1, anticorps mADAT1, anticorps adenosine deaminase, tRNA specific 1, anticorps adenosine deaminase, tRNA-specific 1, anticorps ADAT1, anticorps adat1, anticorps Adat1

Sujet: ADAT1 is a member of the ADAR (adenosine deaminase acting on RNA) family. Using site-specific adenosine modification, the family participates in the pre-mRNA editing of nuclear transcripts. ADAT1, tRNA-specific adenosine deaminase 1, is responsible for the deamination of adenosine 37 to inosine in eukaryotic tRNA.

Poids moléculaire: 39 kDa (MW of target protein)