UPF3B anticorps

N° du produit ABIN629921

Détail du produit anti-UPF3B anticorps

Antigène: UPF3B (UPF3 Regulator of Nonsense Transcripts Homolog B (UPF3B))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UPF3B est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: UPF3 B antibody was raised using a synthetic peptide corresponding to a region with amino acids MKEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKGEDKQDRNKEKKEAL

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UPF3B Blocking Peptide, catalog no. 33R-6132, is also available for use as a blocking control in assays to test for specificity of this UPF3B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UPF3B

Antigène: UPF3B (UPF3 Regulator of Nonsense Transcripts Homolog B (UPF3B))

Autre désignation: UPF3B (UPF3B Produits)

Synonymes: anticorps HUPF3B, anticorps MRXS14, anticorps RENT3B, anticorps UPF3X, anticorps 5730594O13Rik, anticorps AI317193, anticorps AW541158, anticorps RGD1560264, anticorps UPF3B, regulator of nonsense mediated mRNA decay, anticorps UPF3 regulator of nonsense transcripts homolog B (yeast), anticorps UPF3B, anticorps Upf3b

Sujet: UPF3B is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. The protein is one of two functional homologs to yeast Upf3p. This protein binds to the mRNA and remains bound after nuclear export, acting as a nucleocytoplasmic shuttling protein. It forms with Y14 a complex that binds specifically 20 nt upstream of exon-exon junctions.

Poids moléculaire: 52 kDa (MW of target protein)