SNRPA1 anticorps (C-Term)

N° du produit ABIN629923

Détail du produit anti-SNRPA1 anticorps

Antigène: SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))

Épitope: C-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SNRPA1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: SNRPA1 antibody was raised against the C terminal of SNRPA1

Purification: Purified

Immunogène: SNRPA1 antibody was raised using the C terminal of SNRPA1 corresponding to a region with amino acids RRSKTFNPGAGLPTDKKKGGPSPGDVEAIKNAIANASTLAEVERLKGLLQ

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SNRPA1 Blocking Peptide, catalog no. 33R-8161, is also available for use as a blocking control in assays to test for specificity of this SNRPA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRPA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SNRPA1

Antigène: SNRPA1 (SNRPA) (Small Nuclear Ribonucleoprotein Polypeptide A (SNRPA))

Autre désignation: SNRPA1 (SNRPA Produits)

Synonymes: anticorps Mud1, anticorps U1-A, anticorps U1A, anticorps im:7142962, anticorps zgc:101832, anticorps C430021M15Rik, anticorps Rnu1a-1, anticorps Rnu1a1, anticorps mud1, anticorps snf, anticorps fc19d01, anticorps wu:fc19d01, anticorps zgc:77810, anticorps T30B22.12, anticorps U1SNRNP-SPECIFIC PROTEIN, anticorps spliceosomal protein U1A, anticorps small nuclear ribonucleoprotein polypeptide A, anticorps small nuclear ribonucleoprotein polypeptide A', anticorps small nuclear ribonucleoprotein polypeptide A S homeolog, anticorps spliceosomal protein U1A, anticorps SNRPA, anticorps snrpa1, anticorps Snrpa, anticorps snrpa.S, anticorps snrpa, anticorps U1A

Sujet: SNRPA1 contains 3 LRR (leucine-rich) repeats and belongs to the U2 small nuclear ribonucleoprotein A family. It is associated with sn-RNP U2 and helps the A' protein to bind stem loop IV of U2 snRNA.

Poids moléculaire: 18 kDa (MW of target protein)