CPSF3 anticorps (C-Term)
-
- Antigène Voir toutes CPSF3 Anticorps
- CPSF3 (Cleavage and Polyadenylation Specific Factor 3, 73kDa (CPSF3))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CPSF3 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- CPSF3 antibody was raised against the C terminal of CPSF3
- Purification
- Purified
- Immunogène
- CPSF3 antibody was raised using the C terminal of CPSF3 corresponding to a region with amino acids DDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEAL
- Top Product
- Discover our top product CPSF3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CPSF3 Blocking Peptide, catalog no. 33R-1889, is also available for use as a blocking control in assays to test for specificity of this CPSF3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPSF3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CPSF3 (Cleavage and Polyadenylation Specific Factor 3, 73kDa (CPSF3))
- Autre désignation
- CPSF3 (CPSF3 Produits)
- Synonymes
- anticorps CPSF3, anticorps si:dkey-81b15.1, anticorps wu:fc32f10, anticorps zgc:101655, anticorps CPSF-73, anticorps CPSF73, anticorps cleavage and polyadenylation specific factor 3, anticorps cleavage and polyadenylation specificity factor subunit 3, anticorps cleavage and polyadenylation specific factor 3 L homeolog, anticorps cleavage and polyadenylation specific factor 3, 73kDa, anticorps cleavage and polyadenylation specificity factor 3, anticorps CPSF3, anticorps cpsf3, anticorps CpipJ_CPIJ011955, anticorps CMU_024380, anticorps PITG_07110, anticorps cpsf3.L, anticorps Cpsf3
- Sujet
- CPSF3 belongs to the RNA-metabolizing metallo-beta-lactamase-like family, CPSF3 subfamily. It is component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition.
- Poids moléculaire
- 75 kDa (MW of target protein)
-