DRB1 anticorps (N-Term)
-
- Antigène Tous les produits DRB1
- DRB1 (Dopamine Receptor Binding 1 (DRB1))
- Épitope
- N-Term
-
Reactivité
- Souris, Rat, Chien, Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DRB1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DRB1 antibody was raised against the N terminal of DRB1
- Purification
- Purified
- Immunogène
- DRB1 antibody was raised using the N terminal of DRB1 corresponding to a region with amino acids MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGD
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DRB1 Blocking Peptide, catalog no. 33R-5829, is also available for use as a blocking control in assays to test for specificity of this DRB1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DRB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DRB1 (Dopamine Receptor Binding 1 (DRB1))
- Autre désignation
- DRB1 (DRB1 Produits)
- Synonymes
- anticorps dopamine receptor binding 1, anticorps Drb1
- Sujet
- DRB1 is RNA-binding protein with binding specificity for poly(C) and may play an important role in neural development.
- Poids moléculaire
- 36 kDa (MW of target protein)
- Pathways
- TCR Signaling, Positive Regulation of Peptide Hormone Secretion, Production of Molecular Mediator of Immune Response, CXCR4-mediated Signaling Events
-