DAZAP1 anticorps (C-Term)

N° du produit ABIN629928

Détail du produit anti-DAZAP1 anticorps

Antigène: DAZAP1 (DAZ Associated Protein 1 (DAZAP1))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DAZAP1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: DAZAP1 antibody was raised against the C terminal of DAZAP1

Purification: Purified

Immunogène: DAZAP1 antibody was raised using the C terminal of DAZAP1 corresponding to a region with amino acids LAFPPPPSQAAPDMSKPPTAQPDFPYGQYAGYGQDLSGFGQGFSDPSQQP

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DAZAP1 Blocking Peptide, catalog no. 33R-4764, is also available for use as a blocking control in assays to test for specificity of this DAZAP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DAZAP1

Antigène: DAZAP1 (DAZ Associated Protein 1 (DAZAP1))

Autre désignation: DAZAP1 (DAZAP1 Produits)

Synonymes: anticorps MGC89358, anticorps DAZAP1, anticorps 2410042M16Rik, anticorps mPrrp, anticorps DAZ associated protein 1, anticorps DAZ associated protein 1 L homeolog, anticorps dazap1, anticorps DAZAP1, anticorps Dazap1, anticorps dazap1.L

Sujet: In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis.

Poids moléculaire: 45 kDa (MW of target protein)