DDX50 anticorps

N° du produit ABIN629940

Détail du produit anti-DDX50 anticorps

Antigène: DDX50 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 50 (DDX50))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDX50 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: DDX50 antibody was raised using a synthetic peptide corresponding to a region with amino acids EESESQKKERQKSDRRKSRHHYDSDEKSETRENGVTDDLDAPKAKKSKMK

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDX50 Blocking Peptide, catalog no. 33R-2388, is also available for use as a blocking control in assays to test for specificity of this DDX50 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX50 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDX50

Antigène: DDX50 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 50 (DDX50))

Autre désignation: DDX50 (DDX50 Produits)

Synonymes: anticorps GU2, anticorps GUB, anticorps RH-II/GuB, anticorps mcdrh, anticorps 4933429B04Rik, anticorps 8430408E17Rik, anticorps RH-II, anticorps DDX50, anticorps DDX21, anticorps DExD-box helicase 50, anticorps DEAD (Asp-Glu-Ala-Asp) box polypeptide 50, anticorps DExD-box helicase 21, anticorps DDX50, anticorps Ddx50, anticorps DDX21

Sujet: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.

Poids moléculaire: 81 kDa (MW of target protein)