NOVA2 anticorps (Middle Region)
-
- Antigène Voir toutes NOVA2 Anticorps
- NOVA2 (Neuro-Oncological Ventral Antigen 2 (NOVA2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NOVA2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NOVA2 antibody was raised against the middle region of NOVA2
- Purification
- Purified
- Immunogène
- NOVA2 antibody was raised using the middle region of NOVA2 corresponding to a region with amino acids EPEQVHKAVSAIVQKVQEDPQSSSCLNISYANVAGPVANSNPTGSPYASP
- Top Product
- Discover our top product NOVA2 Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NOVA2 Blocking Peptide, catalog no. 33R-2631, is also available for use as a blocking control in assays to test for specificity of this NOVA2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOVA2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NOVA2 (Neuro-Oncological Ventral Antigen 2 (NOVA2))
- Autre désignation
- NOVA2 (NOVA2 Produits)
- Synonymes
- anticorps NOVA2, anticorps anova, anticorps nova3, anticorps MGC97842, anticorps nova1a, anticorps ANOVA, anticorps NOVA3, anticorps Gm1424, anticorps nova1, anticorps NOVA alternative splicing regulator 2, anticorps neuro-oncological ventral antigen 2, anticorps neuro-oncological ventral antigen 2 L homeolog, anticorps NOVA2, anticorps nova2, anticorps Nova2, anticorps nova2.L
- Sujet
- NOVA2 may regulate RNA splicing or metabolism in a specific subset of developing neurons. It binds single strand RNA.
- Poids moléculaire
- 54 kDa (MW of target protein)
-